Transcript | Ll_transcript_17481 |
---|---|
CDS coordinates | 2-493 (+) |
Peptide sequence | FNVILVFLSRTFNLSLLKRKMRRVCNLELALFPSYNSNHHNNNINNPIMEASSGSPKIEQVHYHDQQQRQQKEQQNTLTIFYDGKICVSDVTELQARSILMLANKTMEERVKTPSGLEPSTPTVVESHQPLYSPATPLSMKRSLQRFLQKRKTRKQEASPYNH* |
ORF Type | 5prime_partial |
Blastp | Protein TIFY 5A from Arabidopsis with 40.28% of identity |
---|---|
Blastx | Protein TIFY 5A from Arabidopsis with 36.81% of identity |
Eggnog | TIFY 5A-like(ENOG410Z61E) |
Kegg | Link to kegg annotations (AT1G30135) |
CantataDB | Link to cantataDB annotations (CNT0000670) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418305.1) |
Pfam | tify domain (PF06200.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer