Protein coding transcript 184723

• Transcript: Ll_transcript_962
• CDS coordinates: 768-1400 (+)
• Peptide sequence: MNIDATCSAYRNGFKREGAGRGNWGTQDDEIAKVTDEVPSETEKNLGDEKPAVEEDAADAKKESPANETEEKEPEDKEMTLEEYEKVLEEKRKALQALKTEQRKVDTKEFESMQPLSSKKNNHEIFAKLGSDKDKRKDGIEKEEKSKKSVSINEFLKPAAGESFYNPGGRGRGRGRGARSGGGGFRGNSTSNAPAPAIEDPGHFPTLGGK*
• ORF Type: complete

Annotations of Ll_transcript_962

• Blastp: RGG repeats nuclear RNA binding protein B from Arabidopsis with 58.99% of identity
• Blastx: RGG repeats nuclear RNA binding protein B from Arabidopsis with 42.28% of identity
• Eggnog: SERPINE1 mRNA binding protein 1(ENOG410YBHR)
• Kegg: Link to kegg annotations (AT4G17520)
• CantataDB: Link to cantataDB annotations (CNT0001522)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460244.1)
• Pfam: Hyaluronan / mRNA binding family (PF04774.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;