Protein coding transcript 185706

• Transcript: Ll_transcript_1
• CDS coordinates: 1192-1986 (+)
• Peptide sequence: MLVLLFDRPEEIYHVTVMPCYDKKLEAARDDFAFQLEPHDEDRRSDVNMIAEVDSVLTTGEILELIQLKDVDFKSLEESPLDRLLTNINEEGYLYGVRGSSGGYAETIFRYAAKTLFGRQIDGPLNFRNIRNSDFQEVTLEVEGKTVLKFALCYGFRNLQNVVRKLKIGKSDYHFLEIMACPSGCLNGGGQIKPKTGQSPKELSQSVETVYMENVMEAEPFNNPIVSSLYEKWLEQPGSEKAQRFMHTQYHSVEKSITSQLQNW*
• ORF Type: complete

Annotations of Ll_transcript_1

• Blastp: Protein NAR1 from Arabidopsis with 66.02% of identity
• Blastx: Protein NAR1 from Arabidopsis with 66.02% of identity
• Eggnog: metallo-sulfur cluster assembly(COG4624)
• Kegg: Link to kegg annotations (AT4G16440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426391.1)
• Pfam: Iron only hydrogenase large subunit, C-terminal domain (PF02906.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;