Transcript | Ll_transcript_519950 |
---|---|
CDS coordinates | 1-348 (+) |
Peptide sequence | SGCKFSAEEERVVIELQAEFGNKWAKIATYLEGRTDNDVKNFWSSRRKRLERILKKPSPPKPVKNKGKTPLHQVQVEEVPACSSNQLEENYNSYPASYIMNTEEIKMVHLPDLTKP |
ORF Type | internal |
Blastp | Probable transcription factor MYB58 from Oryza sativa with 72.97% of identity |
---|---|
Blastx | Probable transcription factor MYB58 from Oryza sativa with 85.19% of identity |
Eggnog | Myblike DNAbinding domain containing protein(COG5147) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452004.1) |
Pfam | Myb-like DNA-binding domain (PF00249.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer