Protein coding transcript 189526

• Transcript: Ll_transcript_101195
• CDS coordinates: 697-1227 (+)
• Peptide sequence: MVQSELDSDKVDYTGINDVKSGSLGSGLRREPSFSRWCDDGVVHLDQELGNVEDTSVEEDSDFELPFIQKFELQGGSLDRLKLFHLKFQQRSLHLNGVSTMDEDTIHHRGNGSEKYVTFDIENESNGGITGVESSFSVDAHDSLEKSVTNPISIANILKALFFIIVWYTFSLLLTL*
• ORF Type: complete

Annotations of Ll_transcript_101195

• Blastp: Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 44.19% of identity
• Blastx: Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 58.7% of identity
• Eggnog: membrane(COG0697)
• Kegg: Link to kegg annotations (AT1G06470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461155.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;