Transcript | Ll_transcript_101195 |
---|---|
CDS coordinates | 697-1227 (+) |
Peptide sequence | MVQSELDSDKVDYTGINDVKSGSLGSGLRREPSFSRWCDDGVVHLDQELGNVEDTSVEEDSDFELPFIQKFELQGGSLDRLKLFHLKFQQRSLHLNGVSTMDEDTIHHRGNGSEKYVTFDIENESNGGITGVESSFSVDAHDSLEKSVTNPISIANILKALFFIIVWYTFSLLLTL* |
ORF Type | complete |
Blastp | Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 44.19% of identity |
---|---|
Blastx | Probable sugar phosphate/phosphate translocator At1g06470 from Arabidopsis with 58.7% of identity |
Eggnog | membrane(COG0697) |
Kegg | Link to kegg annotations (AT1G06470) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461155.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer