Protein coding transcript 189620

• Transcript: Ll_transcript_101481
• CDS coordinates: 1614-1940 (+)
• Peptide sequence: MFAIFYVFISLMSLFFNNHLNVLFYFVDTDPLLSPSYVPFIFGIIVPFLVECRFLVPADLTVGQFVYVVRKRIKLSSEKAIFIFVKNILPPTGNFASGVIYIVIFVFL*
• ORF Type: complete

Annotations of Ll_transcript_101481

• Blastp: Autophagy-related protein 8e from Arabidopsis with 70.37% of identity
• Blastx: Autophagy-related protein 8e from Arabidopsis with 71.15% of identity
• Eggnog: Microtubule-associated protein 1 light chain 3(ENOG4111JAT)
• Kegg: Link to kegg annotations (AT2G45170)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017425972.1)
• Pfam: Autophagy protein Atg8 ubiquitin like (PF02991.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;