Protein coding transcript 190

• Transcript: Ll_transcript_325117
• CDS coordinates: 1-789 (+)
• Peptide sequence: IAPNFTPKALSTYTALQQIIILKHLKTWVKMSEQKKSPIPIRILARDMNLDTSQTVFVGPYLGLKAREGFERDYFLFNVGLMKLPFDFPGTAFRNARLAVDRLIGTLATCTEMSKLRMEKGEEPSCLIDFWMQDTLREMAEANYAGGEMPPPFSSNSEIGGYLFDFLFAAQDASTSSLLWAVTLLDSHPEVLAKVREEVARIWSQESDELITAEQLREMKYTHTVAREVVRYRPPATLVPHIAAEEFPLTESYKVPKGAIVFP
• ORF Type: internal

Annotations of Ll_transcript_325117

• Blastp: Cytochrome P450 710A11 from Lycopersicon with 65.53% of identity
• Blastx: Cytochrome P450 710A11 from Lycopersicon with 65.53% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418092.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;