Transcript | Ll_transcript_325117 |
---|---|
CDS coordinates | 1-789 (+) |
Peptide sequence | IAPNFTPKALSTYTALQQIIILKHLKTWVKMSEQKKSPIPIRILARDMNLDTSQTVFVGPYLGLKAREGFERDYFLFNVGLMKLPFDFPGTAFRNARLAVDRLIGTLATCTEMSKLRMEKGEEPSCLIDFWMQDTLREMAEANYAGGEMPPPFSSNSEIGGYLFDFLFAAQDASTSSLLWAVTLLDSHPEVLAKVREEVARIWSQESDELITAEQLREMKYTHTVAREVVRYRPPATLVPHIAAEEFPLTESYKVPKGAIVFP |
ORF Type | internal |
Blastp | Cytochrome P450 710A11 from Lycopersicon with 65.53% of identity |
---|---|
Blastx | Cytochrome P450 710A11 from Lycopersicon with 65.53% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418092.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer