Protein coding transcript 191189

• Transcript: Ll_transcript_69660
• CDS coordinates: 1-453 (+)
• Peptide sequence: GTITWALTRFSLFSRPGSPYKYISERFLLHPFTQIRVFEGSTSTAMAPPKQRTPRVTRNPELIRGIGKYSRSKVYHKRGLWAIKAKNGGVLPRHEPKAKPAAPAEKAPKFYPADDVKKPRLNKHKPRPTKLRSVTIIFFFLYIFELGNVN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_69660

• Blastp: 60S ribosomal protein L6 from Cryophytum with 73.86% of identity
• Blastx: 60S ribosomal protein L6 from Cryophytum with 73.86% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435486.1)
• Pfam: Ribosomal protein L6, N-terminal domain (PF03868.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;