Transcript | Ll_transcript_69660 |
---|---|
CDS coordinates | 1-453 (+) |
Peptide sequence | GTITWALTRFSLFSRPGSPYKYISERFLLHPFTQIRVFEGSTSTAMAPPKQRTPRVTRNPELIRGIGKYSRSKVYHKRGLWAIKAKNGGVLPRHEPKAKPAAPAEKAPKFYPADDVKKPRLNKHKPRPTKLRSVTIIFFFLYIFELGNVN* |
ORF Type | 5prime_partial |
Blastp | 60S ribosomal protein L6 from Cryophytum with 73.86% of identity |
---|---|
Blastx | 60S ribosomal protein L6 from Cryophytum with 73.86% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435486.1) |
Pfam | Ribosomal protein L6, N-terminal domain (PF03868.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer