Transcript | Ll_transcript_325134 |
---|---|
CDS coordinates | 2-436 (+) |
Peptide sequence | ARGLTMGAYKYIQELYRKKQSDVIRFLLRIRVWQFRQLTKLHRSPRPSRPDKARRMGYKAKHGYCVFRIRVRRGGRKKPVPKGAVFGKPKSQGVNQLKPTRNLQSLAEERVGRRVGGLRVLNSYWIAEDSTYKYYEVICIDPKHK |
ORF Type | internal |
Blastp | 60S ribosomal protein L15 from Chironomus with 78.42% of identity |
---|---|
Blastx | 60S ribosomal protein L15 from Chironomus with 78.42% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003549922.2) |
Pfam | Ribosomal L15 (PF00827.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer