Protein coding transcript 195

• Transcript: Ll_transcript_328859
• CDS coordinates: 1-666 (+)
• Peptide sequence: VVAMHEKAMNTPVRRNSMCCSHNLLRISLSLIFMSTLVQIASASNSTSTHGMNNSYKRFIKVKCNSTTYPTYCYKSLSPYASTIKTNTLTLTKISIHVALKAAKNVSSTLKRVSKAKGRLSHAETALIGDCKENIGDTVDLLQQSADGLKDLNGTSTYEERFEWDTIKTWMSASITDVGTCTDEFDELKVRASIQKKIKPAIAHVAWLNSIALALVNTLSY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_328859

• Blastp: Pectinesterase inhibitor 4 from Arabidopsis with 37.13% of identity
• Blastx: Pectinesterase inhibitor 4 from Arabidopsis with 37.13% of identity
• Eggnog: Invertase pectin methylesterase inhibitor(ENOG411155Q)
• Kegg: Link to kegg annotations (AT4G25250)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412710.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;