Protein coding transcript 196

• Transcript: Ll_transcript_328885
• CDS coordinates: 2-421 (+)
• Peptide sequence: LPFTAPFIVCGDKMSSAFTKCSKIQSIVKLRQMLRQWRDKAHRSFHRTPSDVPSGHLAVCVGINQTRFVVRTSYLNHPVFKKLLVEAEEEYGFSNHGPLAIPCEESLFQEVIHFISRSESGIESQPLLHRYRIQGYVDG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_328885

• Blastp: Auxin-responsive protein SAUR50 from Arabidopsis with 38.61% of identity
• Blastx: Auxin-responsive protein SAUR50 from Arabidopsis with 38.61% of identity
• Eggnog: auxin-induced protein(ENOG410Z28U)
• Kegg: Link to kegg annotations (AT4G34760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431413.1)
• Pfam: Auxin responsive protein (PF02519.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;