Protein coding transcript 196676

• Transcript: Ll_transcript_65404
• CDS coordinates: 2-679 (+)
• Peptide sequence: VLLKWHCIFLGKSIAYIFYTTKYKHAFIFHCRLLTLYLSFRTLPNISREEFELIFDELDDTHDVKINKDEFADICNAIALKFQKEECLSYFEYLAFYHSPTSKKLKAFVKSPMFGYLVSFILLLNLGAVIVETTLDIQNSSAQKVWQVVEFIFGWIYVIEMALKVYSFGFENYWRDGQNRFDFIITLIIVIGETITFASSDGQTFFSNGEWIRYLLLAIMLRLIRL
• ORF Type: internal

Annotations of Ll_transcript_65404

• Blastp: Two pore calcium channel protein 1 from Arabidopsis with 71.43% of identity
• Blastx: Two pore calcium channel protein 1 from Arabidopsis with 69.54% of identity
• Eggnog: Two pore segment channel 1(ENOG410XZT8)
• Kegg: Link to kegg annotations (AT4G03560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437005.1)
• Pfam: Ion transport protein (PF00520.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;