Transcript | Ll_transcript_65404 |
---|---|
CDS coordinates | 2-679 (+) |
Peptide sequence | VLLKWHCIFLGKSIAYIFYTTKYKHAFIFHCRLLTLYLSFRTLPNISREEFELIFDELDDTHDVKINKDEFADICNAIALKFQKEECLSYFEYLAFYHSPTSKKLKAFVKSPMFGYLVSFILLLNLGAVIVETTLDIQNSSAQKVWQVVEFIFGWIYVIEMALKVYSFGFENYWRDGQNRFDFIITLIIVIGETITFASSDGQTFFSNGEWIRYLLLAIMLRLIRL |
ORF Type | internal |
Blastp | Two pore calcium channel protein 1 from Arabidopsis with 71.43% of identity |
---|---|
Blastx | Two pore calcium channel protein 1 from Arabidopsis with 69.54% of identity |
Eggnog | Two pore segment channel 1(ENOG410XZT8) |
Kegg | Link to kegg annotations (AT4G03560) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437005.1) |
Pfam | Ion transport protein (PF00520.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer