Protein coding transcript 198

• Transcript: Ll_transcript_328882
• CDS coordinates: 3-311 (+)
• Peptide sequence: WVDLIKSARFKELAPYDPDWFYVRCAALVRHIYFRSPVGVGAVTKVFGGRKSNGVRPSHFCRGAGGVARKALQALEQLKLIEKTEGGRRLTSNGRRDLDRIAA
• ORF Type: internal

Annotations of Ll_transcript_328882

• Blastp: 40S ribosomal protein S19a from Sophophora with 69.61% of identity
• Blastx: 40S ribosomal protein S19a from Sophophora with 69.61% of identity
• Eggnog: Ribosomal protein(COG2238)
• Kegg: Link to kegg annotations (Dmel_CG4464)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442737.1)
• Pfam: Ribosomal protein S19e (PF01090.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;