Protein coding transcript 198726

• Transcript: Ll_transcript_112337
• CDS coordinates: 772-1248 (+)
• Peptide sequence: MLLRHTRKFEPFGICKLLNTFFVTTLFFLWFILYTELWCWDVENAQFIKTASYLFQAYELWREGRGVEFLDPLLDDTTLPFKIMRRMQIALLCVQENSADRPSMLEFDSMFKNDGAVISTPKVPGFSIKKKEHEEETSYSGIKYSSINDVTVSQLAPR*
• ORF Type: complete

Annotations of Ll_transcript_112337

• Blastp: Cysteine-rich receptor-like protein kinase 14 from Arabidopsis with 31.85% of identity
• Blastx: G-type lectin S-receptor-like serine/threonine-protein kinase At1g11330 from Arabidopsis with 64.71% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G23220)
• CantataDB: Link to cantataDB annotations (CNT0000159)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016199915.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;