Protein coding transcript 199

• Transcript: Ll_transcript_333687
• CDS coordinates: 3-635 (+)
• Peptide sequence: ITHNTTAKMPENRNNNKDGVTTAYPSWIHAQDQTGSTGLDSKMDPPAAWTQIEHWDNDGKPYLKEYEGRGQLDGKAALITGGDSGIGRSVAILMAREGADITICYLPHEKEDADWTIKYIEKAGRKAHGFAADLKDLDNAKKAVEEHMRVHGRLNILVPNAAQQEMCMNHKDIDLQVMQETFQLNILSMMAICKYALHHMPRGSVIITCGS
• ORF Type: internal

Annotations of Ll_transcript_333687

• Blastp: Uncharacterized oxidoreductase YhxD from Bacillus with 41.89% of identity
• Blastx: Uncharacterized oxidoreductase YhxD from Bacillus with 41.89% of identity
• Eggnog: Short-chain dehydrogenase reductase Sdr(ENOG410XNUN)
• Kegg: Link to kegg annotations (BSU10430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016205501.1)
• Pfam: short chain dehydrogenase (PF00106.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;