Transcript | Ll_transcript_125208 |
---|---|
CDS coordinates | 136-981 (+) |
Peptide sequence | MDFIPFHDGNIHSFLHSRYLHTRYDVNHSLQTHSSLIRRLSQERELEGHLGCVNAVAWNSKGSLLISGSDDTRINIWNYSDRKLLHSIDTGHSANIFCTKFVPETSDELVVSGAGDAEVRLFNLSCLNGRGPGNNAIVPSALYQCHTRRVKKLAVENGNPNVVWSASEDGTLRQHDFREGTSCPPAGSSHQECRNVLLDLRSGAKRSLADPPKQVLALKSCDISTTRPHLLLVGGSDAFARLYDRRMLPPLSSCRKRMSPPPCVNYFCPMHLSDRVSPLLY* |
ORF Type | complete |
Blastp | WD and tetratricopeptide repeats protein 1 from Homo with 38.62% of identity |
---|---|
Blastx | WD and tetratricopeptide repeats protein 1 from Homo with 38.62% of identity |
Eggnog | WD and tetratricopeptide repeats(ENOG410XWAR) |
Kegg | Link to kegg annotations (23038) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438517.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer