Protein coding transcript 204

• Transcript: Ll_transcript_318308
• CDS coordinates: 143-700 (+)
• Peptide sequence: MASPPLPVAYQAWTSQAVPDWLNKGDNAWQMVAATLVGIQSMPGLVILYGSIVKKKWAVNSAFMALYAFAAVIICWVTWGYKMSFGEKLLPFWGKAGPALGQSFLIKQAALPATPHYYKNGVLETGEVEPYYPMATMVWFQGVFAAIALVILAGSVLARMSFRAWMLFVPLWLTFSYTIGAFSLWG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_318308

• Blastp: Ammonium transporter 3 member 2 from Oryza sativa with 74.59% of identity
• Blastx: Ammonium transporter 3 member 2 from Oryza sativa with 72.73% of identity
• Eggnog: ammonium Transporter(COG0004)
• Kegg: Link to kegg annotations (4334717)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464769.1)
• Pfam: Ammonium Transporter Family (PF00909.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;