Protein coding transcript 205113

• Transcript: Ll_transcript_267339
• CDS coordinates: 203-736 (+)
• Peptide sequence: MRFDICCYGPNGLFPNVSAVRDECDQVSRSPVFKAMLESDMEESRSGTIKIDDVSYDALSAFVNYLYTAEACLDDQMAFDLLVLAEKYEVKHLKAFCEKFLIAGLNLDKATANYAFAHQHNAKQLQDSALALIIDNMDRFTRFEDYADLKDTNPRVVVEIFEAYLAKQVNTASPLKL*
• ORF Type: complete

Annotations of Ll_transcript_267339

• Blastp: BTB/POZ domain-containing protein At4g08455 from Arabidopsis with 66.67% of identity
• Blastx: BTB/POZ domain-containing protein At4g08455 from Arabidopsis with 66.67% of identity
• Eggnog: meprin and TRAF homology domain-containing protein MATH domain-containing protein(ENOG410XQV8)
• Kegg: Link to kegg annotations (AT4G08455)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464120.1)
• Pfam: BTB/POZ domain (PF00651.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;