| Transcript | Ll_transcript_268065 |
|---|---|
| CDS coordinates | 117-1088 (+) |
| Peptide sequence | MMSISTPTVTFLSSSSSQLHLFPIPNPKPNSTLLRRTQFLTSASNSQPSTTPPPLPQPSHKKSFAVATGELFLGLATRFIQRRNNSREGYSDSGSNSILFENASNVEELKGGIFDERIGNLVVEDETQPDIIWEQREKDVEAERNLRVITSPGFSFSAAGLLFPYHLGAAQFLIQNGYITETTPLAGSSAGAIVCAVIASGASMEEALKATKVLAEDCRSRGTAFRLGAVLRDVLVDFLPEDAHIRSNGRVRVGVTQLLWRPRGLLVDQFDSKEDLINAVFTSSFIPGYLAPRPATMFRNRLCVDGGLTLFMPPTSAAKTVLS* |
| ORF Type | complete |
| Blastp | Patatin-like phospholipase domain-containing protein 4 from Homo with 34.09% of identity |
|---|---|
| Blastx | Patatin-like phospholipase domain-containing protein 4 from Homo with 34.09% of identity |
| Eggnog | Patatin-like phospholipase domain containing(ENOG410XSQS) |
| Kegg | Link to kegg annotations (8228) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019418463.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer