Protein coding transcript 206623

• Transcript: Ll_transcript_248660
• CDS coordinates: 353-727 (+)
• Peptide sequence: MGNVNEREQVFNVNVASEVQQSHEGEEECEIVSPSQLLMMMGQVPSPSPRVTHSPFMFTPQVTNFHFFSISLSLFHNSRVNGFSLFSIFSLPIVKSSIFYIYLIPPPLISGVSKLIIKSQTKST*
• ORF Type: complete

Annotations of Ll_transcript_248660

• Blastp: SNF1-related protein kinase regulatory subunit beta-2 from Arabidopsis with 42.47% of identity
• Blastx: SNF1-related protein kinase regulatory subunit beta-2 from Arabidopsis with 67.21% of identity
• Eggnog: Protein kinase, AMP-activated, beta(ENOG410XRB3)
• Kegg: Link to kegg annotations (AT4G16360)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419186.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;