Protein coding transcript 2154

• Transcript: Ll_transcript_459102
• CDS coordinates: 33-746 (+)
• Peptide sequence: MSSTDLKFEGWVGLDANAAKGNMVWQSYEPKAFQETDIDIEITHSGICGSDIHTLQSGWGPTTYPCVVGHEIVGKAIRVGNDVKNGVKVGDRVGVGAQSGACLKGDCASCADGSENYCQSMVGTYNSKWPTGEKSYGGYSRHWRGDSHFVFAIPDGVDSAEAAPMLCGGVTLYSPLKQNGCGPGKRVGIVGIGGLGHFGLLWAKALGADEVVAISRTDSKKEDAFKMGATKFIATAEE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_459102

• Blastp: NADP-dependent alcohol dehydrogenase 6 from Saccharomyces with 53.08% of identity
• Blastx: NADP-dependent alcohol dehydrogenase 6 from Saccharomyces with 50.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YMR318C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020216801.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;