Protein coding transcript 221

• Transcript: Ll_transcript_352621
• CDS coordinates: 24-419 (+)
• Peptide sequence: MGRRPARCYRYCKNKPFPKSRYNRGVPDPKIRIFDLGRQRAAVDDFPFCAHMVSDEYEQLSSEALEAARICCNKYIVKTSGKDSFHLRVRAHPFHIVRINKMLSCAGADRLQQGMRGAWGKPYGCVARVNIG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_352621

• Blastp: 60S ribosomal protein L10-B from Schizosaccharomyces with 82.58% of identity
• Blastx: 60S ribosomal protein L10-B from Schizosaccharomyces with 82.58% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAP7G5.05)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003553186.2)
• Pfam: Ribosomal protein L16p/L10e (PF00252.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;