Protein coding transcript 221093

• Transcript: Ll_transcript_189545
• CDS coordinates: 204-512 (+)
• Peptide sequence: MNPNYTEFKFPQIKAHPWHKVFHKKMPREAVDLVSRMLQYSPNLRCTALEACAHPFFDNLRDPKVFLPNGRAMPPLFDFTAQELAGAPDELRRRLIPEHARS*
• ORF Type: complete

Annotations of Ll_transcript_189545

• Blastp: Shaggy-related protein kinase theta from Arabidopsis with 84.31% of identity
• Blastx: Shaggy-related protein kinase theta from Arabidopsis with 83.76% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G00720)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464846.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;