Protein coding transcript 221540

• Transcript: Ll_transcript_11365
• CDS coordinates: 72-467 (+)
• Peptide sequence: MLGKNIRPAFGTSWKEELCEGKLVEGKIDPGSPAVLIISSSALRCIELLRGFRSFTKECHAVKLFSKHMKVEEQIPLLKNRVNIASGTPSRIKKLIDIEALSLSRLKVLVLDMQPDVKGYSLLTLPQVRFG*
• ORF Type: complete

Annotations of Ll_transcript_11365

• Blastp: Protein CMSS1 from Mus with 38.52% of identity
• Blastx: Protein CMSS1 from Mus with 36.55% of identity
• Eggnog: cms1 ribosomal small subunit homolog (yeast)(ENOG410XPW6)
• Kegg: Link to kegg annotations (66497)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452516.1)
• Pfam: U3-containing 90S pre-ribosomal complex subunit (PF14617.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;