Transcript | Ll_transcript_11398 |
---|---|
CDS coordinates | 72-599 (+) |
Peptide sequence | MLGKNIRPAFGTSWKEELCEGKLVEGKIDPGSPAVLIISSSALRCIELLRGFRSFTKECHAVKLFSKHMKVEEQIPLLKNRVNIASGTPSRIKKLIDIEALSLSRLKVLVLDMQPDVKGYSLLTLPQVRDEFWDLFKNYYYEAMIKGDLRICLYGPYELAVRLKGKKGDSAAKKE* |
ORF Type | complete |
Blastp | Protein CMSS1 from Xenopus with 36.73% of identity |
---|---|
Blastx | Protein CMSS1 from Xenopus with 36.73% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (447375) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452516.1) |
Pfam | U3-containing 90S pre-ribosomal complex subunit (PF14617.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer