Protein coding transcript 225720

• Transcript: Ll_transcript_172093
• CDS coordinates: 247-1233 (+)
• Peptide sequence: MRKWLCCNCQVEESYSSNEYEHQKSPRHYGDGNNKGSKASAPTKPETQKAPPPIEVPALSLDELKEKTDNFGSKALIGEGSYGRAYYATLNDGNAVAVKKLDISSEPESNNEFLTQVSMVSRLKNDNFVELHGYCVEGNLRILAYEFATMGSLHDILHGRKGVQGAQPGPTLDWIQRVRIAVGAARGLEYLHEKVQPAVIHRDIRSSNVLIFEDFKAKIADFNLSNQSPDMAARLHSTRVLGTFGYHAPEYAMTGQLTQKSDVYSFGVVLLELLTGRKPVDHTMPRGQQSLVTWVSFPAYTYFSYLPMVVTNRYFVDVDDFAGYPQIK*
• ORF Type: complete

Annotations of Ll_transcript_172093

• Blastp: PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 85.14% of identity
• Blastx: PTI1-like tyrosine-protein kinase 3 from Arabidopsis with 81.56% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G59350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452534.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;