Protein coding transcript 226289

• Transcript: Ll_transcript_171209
• CDS coordinates: 253-1254 (+)
• Peptide sequence: MLASDPTSLLRPKASLPDPNPTRSLFTARFCFGPRSWSRPSFTVGPKFSVNSVEMELLRRIGRGCFRNPRLKVEANIGGEDFFDATAAMAKPVPSHLVIMVNGIIGSASDWRYAAEQFVKKLPDKVVVHRSECNSSKLTFDGVDTMGERLAEEVLSVIRRWPEVQKISFVAHSLGGLVARYAIGRLYEYSSTLEPLGTNRNCSIEEKTEYSKQFLEQRNEAKIAGLEPMNFITFATPHLGSRGNRQLPFLCGLPFLERSASQTAHLVAGRSGKHLFLMDNDEGKPPLLLRMVDDSDDLKFMSALRAFKRRVAYANANYDRILLILVLNNTCDQ*
• ORF Type: complete

Annotations of Ll_transcript_171209

• Blastp: Putative lipase YOR059C from Saccharomyces with 26.5% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 43.04% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YOR059C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417721.1)
• Pfam: Putative serine esterase (DUF676) (PF05057.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;