Protein coding transcript 226914

• Transcript: Ll_transcript_100008
• CDS coordinates: 3-368 (+)
• Peptide sequence: SIWAVGDVTNRVNLTPVALMEGTCFAKTVFGGQPSKPDYGYVPYAVFSIPPLSVVGFSEEEAIEHTNGDLLVFTSTFNPMKNTISGRQEKTVMKLLVDAETDKVLGASMCGPDAPEIMQVS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_100008

• Blastp: Glutathione reductase, cytosolic from Pisum with 84.03% of identity
• Blastx: Glutathione reductase, cytosolic from Pisum with 84.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000776)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461512.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain (PF02852.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;