Protein coding transcript 228592

• Transcript: Ll_transcript_55500
• CDS coordinates: 245-868 (+)
• Peptide sequence: MESSSNFTPFLLFLSATLTVLSSVSANSEGDALYALKRSFSDPDNVLQSWDPTLVSPCTWFHVTCNQNNRVTRLDLGNSNLSGHLVPELEKLEHLQYLELYKNNIQGVIPPELGNLKNLVSLDLYNNNISGIIPPSLGNLKNLVFLRLNDNRLTGPIPKELVGPPNLKVVDVSNNDLCGTIPTTGPFEHIPLNNFENNPRLEGPELLG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_55500

• Blastp: Leucine-rich repeat protein 1 from Arabidopsis with 80.4% of identity
• Blastx: Leucine-rich repeat protein 1 from Arabidopsis with 84.62% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT5G21090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434355.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;