Protein coding transcript 23563

• Transcript: Ll_transcript_365501
• CDS coordinates: 603-1394 (+)
• Peptide sequence: MNLFLLLFSLLVGWKNSFSVIIGGDEVRTGKPSPEIFLEAARRLSVEPSNCLVIEDSLPGVTAGKAAGMEVVAVPSLPKQAHLYTAADEVISSLLDLQLKNWGLPPFEDWVEGTLPLDRWHIGGPVVKGFGRGSKILGIPTANLSAEGYSDLLQEHPAGVYFGWAGLSSRGVFKMVMSVGWNPYFNNKEKTFEPWLLHDFNEDFYGEELRLVIVGYIRPEANFPSLESLIAKIHEDRRFAEKALDLPLYSRYKNDSYLRSSQS*
• ORF Type: complete

Annotations of Ll_transcript_365501

• Blastp: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 78.05% of identity
• Blastx: Bifunctional riboflavin kinase/FMN phosphatase from Arabidopsis with 78.05% of identity
• Eggnog: riboflavin biosynthesis protein ribF(COG0196)
• Kegg: Link to kegg annotations (AT4G21470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431450.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;