Protein coding transcript 237247

• Transcript: Ll_transcript_216201
• CDS coordinates: 218-727 (+)
• Peptide sequence: MSSVVTAAVSFSPSSTLPTRTSLSALERVPFQRVSFQYRDVSISGRGVSIRAQVTTDTEAAPITKVVKESKKQDEGVVVNRFKPKDPYTGRCLLNTKITGDDAPGETWHMVFTTEGEVPYREGQSIGVVPDGVDKNGKPHKLRLYSIASSAIGDFGDSKTVSRSLVKVN*
• ORF Type: complete

Annotations of Ll_transcript_216201

• Blastp: Ferredoxin--NADP reductase, chloroplastic from Vicia with 77.44% of identity
• Blastx: Ferredoxin--NADP reductase, chloroplastic from Vicia with 77.44% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000152)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424081.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;