Protein coding transcript 239947

• Transcript: Ll_transcript_57601
• CDS coordinates: 376-777 (+)
• Peptide sequence: MNICFVQRLRLSQNYSEHSDVYSFGVFLLELISGCEAHNKNMSNPYETLVFQAKKHNNGVDNFVDMTLGEHEKCNGARNMMKLALLCVDVSYRRPSMRQIVQELEHIQREIAHLYSQFSEEIGVVTLGSELFQ*
• ORF Type: complete

Annotations of Ll_transcript_57601

• Blastp: Probable LRR receptor-like protein kinase At1g51890 from Arabidopsis with 42.39% of identity
• Blastx: Probable LRR receptor-like protein kinase At1g51890 from Arabidopsis with 42.39% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G51890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447876.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;