Protein coding transcript 245997

• Transcript: Ll_transcript_120982
• CDS coordinates: 563-1144 (+)
• Peptide sequence: MPDMDGFKLLEHIGLEMDLPVIMMSADDGKQVVMKGVTHGACDYLIKPVRIEALKNIWQHVVRRRKNEWKDLEQSGSVDEVDRQLKGSDDADYSSSANEGKSSKKRRDEEEDPDERDDSSTLKKPRVVWSVELHQQFMAAVNQLGLDSKYPSFPFIFSCFSMQSFLSYQNMPQGARELRYISLGFYMYIVGLS*
• ORF Type: complete

Annotations of Ll_transcript_120982

• Blastp: Two-component response regulator ARR2 from Arabidopsis with 70.19% of identity
• Blastx: Two-component response regulator ARR2 from Arabidopsis with 72.11% of identity
• Eggnog: two component, sigma54 specific, transcriptional regulator, Fis family(COG2204)
• Kegg: Link to kegg annotations (AT4G16110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425655.1)
• Pfam: Response regulator receiver domain (PF00072.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;