Protein coding transcript 248106

• Transcript: Ll_transcript_210701
• CDS coordinates: 1692-2441 (+)
• Peptide sequence: MMTPNLNLEPENNSEECSQEASNISLQETPYDLNHTKESTTSSSCLTNLTNAASMTLDLTLNFNSNDAKFKGTSDTSTNIGAEALAPATETPRVFSCNYCRRKFFSSQALGGHQNAHKRERTMAKRAMRMGMFNERYTNLASLPLKGSPFRSLGIEAHAAMHQRYMQMPSALVRVPDMKGGAKFERNHFGAPIFMADDDVSLFWPGSFRRVEHGSCVNLGHAQTSNTSFVPMPLPPPQTSSSPDLTLKL*
• ORF Type: complete

Annotations of Ll_transcript_210701

• Blastp: Zinc finger protein 4 from Arabidopsis with 44.32% of identity
• Blastx: Zinc finger protein 4 from Arabidopsis with 44.32% of identity
• Eggnog: Zinc finger protein(ENOG410ZCT7)
• Kegg: Link to kegg annotations (AT1G66140)
• CantataDB: Link to cantataDB annotations (CNT0001964)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448359.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;