Transcript | Ll_transcript_391078 |
---|---|
CDS coordinates | 1187-2089 (+) |
Peptide sequence | MWTKEETDQLFDLCERFDLRFVVIADRFPSSRTVEELKDRYYSVCRAILIARAPSPGDVAAHPVVKEPYNVSQDIERKRALSMVLSQTRQQERRDEEVLVEAKRIAELRMPAKAVQESQLADASNPGAEVTERTIPGETVSSPMVVSSTLTDNAAILASLRTLHVYLRTYALDQMVQSASSSAGLRTIKRVEQTLHDLGVNLKPRVPTKAVCAEHLELRKEILTLLNLQKQVQYKEAEGSSFRDGSYGESPGTPKDQPFIPEFMSFGGERVGKKDHKRKGHGAPSPSAHKRPRKMKASDL* |
ORF Type | complete |
Blastp | SWR1-complex protein 4 from Arabidopsis with 65.92% of identity |
---|---|
Blastx | SWR1-complex protein 4 from Arabidopsis with 65.92% of identity |
Eggnog | DNA methyltransferase 1 associated protein 1(ENOG410XSA4) |
Kegg | Link to kegg annotations (AT2G47210) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019418319.1) |
Pfam | SANT/Myb-like domain of DAMP1 (PF16282.4) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer