Protein coding transcript 25

• Transcript: Ll_transcript_453198
• CDS coordinates: 3-944 (+)
• Peptide sequence: LLSTLTMASSLIQLHCSTLSLTSNPSILPPRPSVTSFLTKPIGKSRLQAHIPRQVFPVRALTYDGGFGSEDKASGSDDEVSGVAVVEEEKTEVEKVKKLLVDSLYGTDRGLRASRETRSEIVELITQLEALNPTPAPTQALPLLNGKWILAYTSFRGLFPLLSQAIAPFIRAGDISQTIDSETYAVQNSVQFVGPWTTTDVNCHGKYEVRSPKRVQLKIEERVIGTPQLTDSLTIPEEVEFVGQKIDLKPLKGILDEKAKKLSRKPPVRLPVPKPFAESWLLTTYLDEDIRVSRGDFGSVFVFFKEGSSFFTS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_453198

• Blastp: Chromoplast-specific carotenoid-associated protein, chromoplastic from Cucumis with 53.68% of identity
• Blastx: Chromoplast-specific carotenoid-associated protein, chromoplastic from Cucumis with 52.96% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101203857)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425196.1)
• Pfam: PAP_fibrillin (PF04755.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;