Protein coding transcript 251641

• Transcript: Ll_transcript_7463
• CDS coordinates: 1460-1891 (+)
• Peptide sequence: MPLGTAIHNIEITLGKGGQLARAAGAVAKLIAKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKCWLGKRPVVRGVVMNPVDHPHGGGEGRAPIGRKKPATPWGYPALGRRSRKKPATPWGYPALGRRSRK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_7463

• Blastp: 50S ribosomal protein L2, chloroplastic from Carica with 99.22% of identity
• Blastx: 50S ribosomal protein L2, chloroplastic from Cucumis with 98.47% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000963)
• Mirbase: osa-MIR5538 (MI0019059)
• Ncbi protein: Link to NCBI protein (XP_003605908.1)
• Pfam: Ribosomal Proteins L2, C-terminal domain (PF03947.17)
• Rfam: SSU_rRNA_archaea (RF01959)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;