Protein coding transcript 255024

• Transcript: Ll_transcript_33769
• CDS coordinates: 1-528 (-)
• Peptide sequence: MKQLEKTTGPTYGKTTPNQNVSFNRKDVHKFRTYSPVSVFESSSSSSAENSNSDLPVIPLKRPRGKRQRLSSFNLLLSLPFISTSPAFETWTLGKLVTRVKKKQKKKDLSLLPDHSEMKRSSSQESGVLGKCTHCEVTETPQWREGPMGPKTLCNACGVRYRSGRLFPEYRPANSP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_33769

• Blastp: GATA transcription factor 10 from Arabidopsis with 45.64% of identity
• Blastx: GATA transcription factor 11 from Arabidopsis with 76.36% of identity
• Eggnog: Transcription factor(COG5641)
• Kegg: Link to kegg annotations (AT1G08000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413501.1)
• Pfam: GATA zinc finger (PF00320.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;