Protein coding transcript 258

• Transcript: Ll_transcript_496144
• CDS coordinates: 59-586 (+)
• Peptide sequence: MPKRLTNSYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVASERDFIQRRVQKIIDLKKKVCDGTDKTFVVINQKGIDPVSLDALAKEGIIALRRAKRRNMERLTLACGGSPMNSVDDLTEDCLGYAGLVYEHVLGETKYTFVMECAKPQSVTILIHGPTQYAITQIKDAVRDGLR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_496144

• Blastp: T-complex protein 1 subunit zeta from Oryctolagus with 75% of identity
• Blastx: T-complex protein 1 subunit zeta from Oryctolagus with 73.71% of identity
• Eggnog: t-complex protein 1 subunit(ENOG410XQ3Q)
• Kegg: Link to kegg annotations (100008688)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020219302.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;