Protein coding transcript 26

• Transcript: Ll_transcript_453230
• CDS coordinates: 364-1074 (+)
• Peptide sequence: MMIKFFQPLTASLSSKRKMSYSSFSIIREHNNLFLRGFMILLLSCITIQLNFCISSIPSSLKALPLEGHLSFDEIGLSQASRDFGNRYHAQPMALLHPKSVSDIAVTIKHIWNLGPSSQLTVAARGHGHSLQGQAQAHGGVVINMKSLIAPEMKVYAGELPYVDVSGGESWINILHETLRYGLAPRSWTDYLHLTVGGTLSNAGVSGQAFLHGPQISNVKQLEIVTGTGEVVNCSEE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_453230

• Blastp: Cytokinin dehydrogenase 6 from Arabidopsis with 66.97% of identity
• Blastx: Cytokinin dehydrogenase 6 from Arabidopsis with 67.29% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT3G63440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432619.1)
• Pfam: FAD binding domain (PF01565.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;