Protein coding transcript 260889

• Transcript: Ll_transcript_256361
• CDS coordinates: 1246-1692 (+)
• Peptide sequence: MDKSGRRVLLIISSSIMTVSLLLTSIAFYLGGIVPKDSALSNILALLSVVGVVVMVVGFSLGLGPIPWIIMSEILPVNIKSLAGSIATMANWLTSWVITMTANLLLTWSSGGTFLIYTVVAAFTVAFVALWVPETKGRTLEEIQFSFR*
• ORF Type: complete

Annotations of Ll_transcript_256361

• Blastp: Sugar transporter ERD6-like 6 from Arabidopsis with 69.59% of identity
• Blastx: Sugar transporter ERD6-like 4 from Arabidopsis with 62.18% of identity
• Eggnog: Transporter(ENOG410XNQK)
• Kegg: Link to kegg annotations (AT1G75220)
• CantataDB: Link to cantataDB annotations (CNT0002862)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446728.1)
• Pfam: Sugar (and other) transporter (PF00083.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;