Protein coding transcript 26298

• Transcript: Ll_transcript_521278
• CDS coordinates: 1-1257 (+)
• Peptide sequence: NEVSELVGCSGLRLRMMSISTPTVTFLSSSSSQLHLFPIPNPKPNSTLLRRTQFLTSASNSQPSTTPPPLPQPSHKKSFAVATGELFLGLATRFIQRRNNSREGYSDSGSNSILFENASNVEELKGGIFDERIGNLVVEDETQPDIIWEQREKDVEAERNLRVITSPGFSFSAAGLLFPYHLGAAQFLIQNGYITETTPLAGSSAGAIVCAVIASGASMEEALKATKVLAEDCRSRGTAFRLGAVLRDVLVDFLPEDAHIRSNGRVRVGVTQLLWRPRGLLVDQFDSKEDLINAVFTSSFIPGYLAPRPATMFRNRLCVDGGLTLFMPPTSAAKTVRVCAFPASRLGLKGVGISPDCNPENACSTRQLFEWALEPADDAILDRLFEFGYLDAAVWAKDNPVEEIVQDVSPVVENSIAV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_521278

• Blastp: Patatin-like phospholipase domain-containing protein 4 from Homo with 33.7% of identity
• Blastx: Patatin-like phospholipase domain-containing protein 4 from Homo with 33.7% of identity
• Eggnog: Patatin-like phospholipase domain containing(ENOG410XSQS)
• Kegg: Link to kegg annotations (8228)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418463.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;