Protein coding transcript 263810

• Transcript: Ll_transcript_115373
• CDS coordinates: 236-535 (-)
• Peptide sequence: MNIRGQVPDICRARVPLICFATVEWHAADRVMRQFGLQQPIPQDPPKFDKLHKMDLRGKHDYNWPQKHEVWIQLWDSRDECVVNGIPQNQPLYHHSQYM*
• ORF Type: complete

Annotations of Ll_transcript_115373

• Blastp: Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 41.9% of identity
• Blastx: Serine/threonine-protein phosphatase 7 long form homolog from Arabidopsis with 42.97% of identity
• Eggnog: Serine threonine-protein phosphatase 7 long form homolog(ENOG410YHBV)
• Kegg: Link to kegg annotations (AT1G48120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432591.1)
• Pfam: Plant mobile domain (PF10536.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;