Protein coding transcript 29150

• Transcript: Ll_transcript_314723
• CDS coordinates: 29-451 (+)
• Peptide sequence: MAKANSEDHNLRSLPIVTPSLSNNSNNKVNNSSNKVNNSNNKVNNNNNNKVNNKNKVIIKSSDMLPQMLNEVVDIALASFEKYNLEKEVAEHIKKEFDKKHGPTWHCIVGRSFGSYVTHETNHFVYFYLDQKAVLLFKSG*
• ORF Type: complete

Annotations of Ll_transcript_314723

• Blastp: Dynein 8 kDa light chain, flagellar outer arm from Chlamydomonas with 62.22% of identity
• Blastx: Dynein 8 kDa light chain, flagellar outer arm from Chlamydomonas with 67.95% of identity
• Eggnog: dynein, light chain(ENOG4111NK2)
• Kegg: Link to kegg annotations (CHLREDRAFT_194837)
• CantataDB: Link to cantataDB annotations (CNT0001158)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462536.1)
• Pfam: Dynein light chain type 1 (PF01221.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;