Protein coding transcript 30947

• Transcript: Ll_transcript_511331
• CDS coordinates: 123-551 (+)
• Peptide sequence: MGWNLLFWFAICFPLHIALLASAFYQVLMLSDLEADYINPYDASSRINYFVLPEFIAQVSMCVLFLVTGHWFMFLITLPLTCYHINLYLKRQHLVDVTEVFRVLNAEKKFRLAKLAFYLVVLIITIFRLVLIGVYYLDLDDE*
• ORF Type: complete

Annotations of Ll_transcript_511331

• Blastp: Protein cornichon homolog 1 from Arabidopsis with 52.11% of identity
• Blastx: Protein cornichon homolog 1 from Arabidopsis with 52.11% of identity
• Eggnog: cornichon homolog(ENOG4111MWH)
• Kegg: Link to kegg annotations (AT3G12180)
• CantataDB: Link to cantataDB annotations (CNT0001553)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444126.1)
• Pfam: Cornichon protein (PF03311.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;