Transcript | Ll_transcript_307943 |
---|---|
CDS coordinates | 1-732 (+) |
Peptide sequence | HNLYIQNKHNHHNLPIIPSIFSHLLFLNAIPLNNEFLWFSLALVPIKIMGFKSLFNRKKKLLKKSTSSPTNLATPIISCATSVSVHSHAEFVEELEQVFKKFDVNGDGKISSSELGSIMGSLGQPSTEEELENMIHEVDADGDGYISLEEFIELNTKGVDSDEVLENLKDAFSVFDVDGNGSITAEELHMVMAGLGEECSPAECQKMISGVDSDGDGMINFEEFKTMMTGSRFQLKEIANVET* |
ORF Type | 5prime_partial |
Blastp | Probable calcium-binding protein CML25 from Arabidopsis with 72.54% of identity |
---|---|
Blastx | Probable calcium-binding protein CML25 from Arabidopsis with 72.54% of identity |
Eggnog | Calcium-binding protein(COG5126) |
Kegg | Link to kegg annotations (AT1G24620) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434968.1) |
Pfam | Secreted protein acidic and rich in cysteine Ca binding region (PF10591.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer