Transcript | Ll_transcript_512945 |
---|---|
CDS coordinates | 327-1064 (+) |
Peptide sequence | MSQPSVILATASYDHTIRFWEAKSGRCYRTIQYPDSQVNRLEITPDKRYLAAAGNPHIRLFDVNANTPQPVMSYDSHTNNVMAVGFQCDGNWMYSGSEDGTVKIWDLRAPGCQREYESRAAVNTVVLHPNQTELISGDQNGNIRVWDLTANSCSCELVPEVDTAVRSLTVMWDGSLVVAANNHGTCYVWRLLQGTQTMTNFEPLHKLQAHKGYILKCLLSPEFCEPHRSYRLCSFCFFILFYHSN* |
ORF Type | complete |
Blastp | Protein LST8 homolog from Dictyostelium with 63.47% of identity |
---|---|
Blastx | Protein LST8 homolog from Dictyostelium with 63.47% of identity |
Eggnog | MTOR associated protein, LST8 homolog (S. cerevisiae)(ENOG410XPVD) |
Kegg | Link to kegg annotations (DDB_G0292592) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419702.1) |
Pfam | WD domain, G-beta repeat (PF00400.31) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer