Protein coding transcript 31353

• Transcript: Ll_transcript_512617
• CDS coordinates: 200-631 (+)
• Peptide sequence: MRRVCNLELALFPSYNSNHHNNNINNPIMEASSGSPKIEQVHYHDQQQRQQKEQQNTLTIFYDGKICVSDVTELQARSILMLANKTMEERVKTPSGLEPSTPTVVESHQPLYSPATPLSMKRSLQRFLQKRKTRKQEASPYNH*
• ORF Type: complete

Annotations of Ll_transcript_512617

• Blastp: Protein TIFY 5A from Arabidopsis with 41.01% of identity
• Blastx: Protein TIFY 5A from Arabidopsis with 36.81% of identity
• Eggnog: TIFY 5A-like(ENOG410Z61E)
• Kegg: Link to kegg annotations (AT1G30135)
• CantataDB: Link to cantataDB annotations (CNT0000670)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418305.1)
• Pfam: tify domain (PF06200.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;