Transcript | Ll_transcript_307913 |
---|---|
CDS coordinates | 1-543 (+) |
Peptide sequence | KKRKYELGRPAANTKLGARRVHIVRTRGGNKKYRALRLDQGNFAWGSEGISAKTRIIDVVYNASNNELVRTKTLVKNAIVVIDATPFRQWYEGHYALPIGRRKTTKLTEAEDAVLNKKRSTKAEVKYKKRQRFAKVEASIDEQFQTSRLLACLGSRPGQCGRADGYILEGKELEFYHRKIK |
ORF Type | internal |
Blastp | 40S ribosomal protein S8 from Spodoptera with 78.45% of identity |
---|---|
Blastx | 40S ribosomal protein S8 from Spodoptera with 78.45% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001236970.2) |
Pfam | Ribosomal protein S8e (PF01201.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer