Protein coding transcript 33

• Transcript: Ll_transcript_307913
• CDS coordinates: 1-543 (+)
• Peptide sequence: KKRKYELGRPAANTKLGARRVHIVRTRGGNKKYRALRLDQGNFAWGSEGISAKTRIIDVVYNASNNELVRTKTLVKNAIVVIDATPFRQWYEGHYALPIGRRKTTKLTEAEDAVLNKKRSTKAEVKYKKRQRFAKVEASIDEQFQTSRLLACLGSRPGQCGRADGYILEGKELEFYHRKIK
• ORF Type: internal

Annotations of Ll_transcript_307913

• Blastp: 40S ribosomal protein S8 from Spodoptera with 78.45% of identity
• Blastx: 40S ribosomal protein S8 from Spodoptera with 78.45% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236970.2)
• Pfam: Ribosomal protein S8e (PF01201.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;