Protein coding transcript 353

• Transcript: Ll_transcript_513826
• CDS coordinates: 1-330 (+)
• Peptide sequence: GNIAQRKICTVAWQKVCSPYSQGGLGLRSLKQINRAALLKLAWDMRTSNHEWAEFFRERFGCNWHHSTRYFKSSIWTSIRDNWAITSDNAIWLVGDGRHVNFWLDNWIGE
• ORF Type: internal

Annotations of Ll_transcript_513826

• Blastp: Putative ribonuclease H protein At1g65750 from Arabidopsis with 33.33% of identity
• Blastx: Putative ribonuclease H protein At1g65750 from Arabidopsis with 33.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423031.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;